General Information

  • ID:  hor005469
  • Uniprot ID:  P68991
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Chimaera monstrosa (Rabbit fish)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Chimaera (genus), Chimaeridae (family), Chimaeriformes (order), Holocephali (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VPTQRLCGSHLVDALYFVCGERGFFYSPKPIRELEPLL
  • Length:  38(1-38)
  • Propeptide:  VPTQRLCGSHLVDALYFVCGERGFFYSPKPIRELEPLLGIVEQCCHNTCSLANLEGYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68991-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005469_AF2.pdbhor005469_ESM.pdb

Physical Information

Mass: 501223 Formula: C201H309N51O53S2
Absent amino acids: MNW Common amino acids: L
pI: 7.25 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 14
Hydrophobicity: 11.84 Boman Index: -3662
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.37
Instability Index: 2787.37 Extinction Coefficient cystines: 3105
Absorbance 280nm: 83.92

Literature

  • PubMed ID:  3053327
  • Title:  Isolation and structural characterization of insulin from the holocephalan fish, Chimaera monstrosa (rabbit fish).